PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C008942P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 103aa    MW: 12208.5 Da    PI: 11.4126
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C008942P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.63.8e-29958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krien++nrqvtfskRrng++KKA+ELS+LCd+++a+i+fs++g+l  +s
  MELO3C008942P1  9 KRIENTTNRQVTFSKRRNGLIKKAYELSILCDIDIALIMFSPSGRLSQFS 58
                    79*********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.871161IPR002100Transcription factor, MADS-box
SMARTSM004322.5E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.36E-31283IPR002100Transcription factor, MADS-box
CDDcd002656.39E-35275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-27323IPR002100Transcription factor, MADS-box
PfamPF003197.8E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-273859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
MGRVKLQIKR IENTTNRQVT FSKRRNGLIK KAYELSILCD IDIALIMFSP SGRLSQFSGR  60
RRIEDVLARY INLPDHDRGR YTHFFLFLVF LFFKKKSFFL KM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-19180179Myocyte-specific enhancer factor 2B
1tqe_Q3e-19180179Myocyte-specific enhancer factor 2B
1tqe_R3e-19180179Myocyte-specific enhancer factor 2B
1tqe_S3e-19180179Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818821e-98LN681882.1 Cucumis melo genomic scaffold, anchoredscaffold00010.
GenBankLN7132621e-98LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008442144.12e-51PREDICTED: agamous-like MADS-box protein AGL11
RefseqXP_011654394.12e-51PREDICTED: MADS-box transcription factor 18-like
SwissprotQ9LM461e-43AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBLA0A0J8C9885e-49A0A0J8C988_BETVU; Uncharacterized protein
TrEMBLW1NFJ14e-50W1NFJ1_AMBTC; Uncharacterized protein
STRINGGSMUA_Achr3P04450_0015e-47(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.11e-42AGAMOUS-like 104